7TOWA

Antibody dh1058 fab fragment bound to sars-cov-2 fusion peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
235
structure length
235
Chain Sequence
QVQLVQSGGGVVQPGRSLRLSCAASGFNFGDFGMHWVRQAPGKGLEWVAVISYEGRNKNHADSVRGRFTISRDNSRNMLYLQMNSLRRGDTAVYYCAKENRDRNYDSWSASYSDYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords DH1058 Fab heavy chain
publication title Structural diversity of the SARS-CoV-2 Omicron spike.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 235
sequence length 235
chains with identical sequence H
ec nomenclature
pdb deposition date 2022-01-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...