7TRHH

Human antibody k03.28 in complex with the influenza hemagglutinin head domain of a/california/07/2009(h1n1)(x-181)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
227
structure length
222
Chain Sequence
VQLVESGGGLIQPGGSLRLSCEASAFTFSSYEMNWVRQAPGKGLEWVSYITSSGSRIYYADSVKGRFTISRDNAKNSLYLQMNSLRVEDTAVYYCARLLDSIVWGEGWYYGMDVWGQGTTVTVSGASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An antibody class that overcomes a steric barrier to cross-group neutralization of influenza viruses
rcsb
molecule tags Immune system/viral protein
source organism Influenza a virus
molecule keywords Hemagglutinin
total genus 42
structure length 222
sequence length 227
ec nomenclature
pdb deposition date 2022-01-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...