7TT7D

Bamabcde bound to substrate espp in the barrelized espp/continuous open bama state
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
102
Chain Sequence
TNMALDDSALQGFFGVDRSDRDPQHARAAFSKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPAYRQMQMNAVAKIIAANSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structures reveal multiple stages of bacterial outer membrane protein folding.
pubmed doi rcsb
molecule tags Membrane protein
source organism Escherichia coli
molecule keywords Outer membrane protein assembly factor BamA
total genus 31
structure length 102
sequence length 129
ec nomenclature
pdb deposition date 2022-01-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...