7TYDA

Crystal structure of fgfr4 domain 3 in complex with a de novo-designed mini-binder in p21 space group
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
98
Chain Sequence
PHRPILQAGLPANTTAVVGSDVELLCKVYSPHIQWLKHIVINGSSFGADGFPYVQVLKTVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Isoform-specific inhibition of FGFR signaling achieved by a de-novo-designed mini-protein.
pubmed doi rcsb
molecule tags Signaling protein
source organism Homo sapiens
molecule keywords Fibroblast growth factor receptor 4
total genus 14
structure length 98
sequence length 108
chains with identical sequence C
ec nomenclature ec 2.7.10.1: receptor protein-tyrosine kinase.
pdb deposition date 2022-02-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...