7TZLA

The dh dehydratase domain of alnb
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
278
structure length
271
Chain Sequence
GHPLVGTRSPVADEPDKYVWELTMDTDTFPWLEDHRVQGPIVFPGAGHLDLVVGCATEAFGPGRYSVENVEFRRPLFVFDDRPAPLVQVVLSPSMHFGVYSLQDGDKEWVLHSEGTVRAGAPDAEPPVPFAELEAHCPLEFDPAKVFAKFRNNGLMLGPTFRVISRLKYGELRSLGRIDTPDTIADEAPRHLIHPALLDACFQSLSIAMGNDDKTLYIPFDVRRFSFHAKAGKRLYCYGQAHVIAYCEGDLWLFNEDGELVAEFEGFKGKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
source organism Streptomyces griseofuscus
publication title The programming of alpha,beta-polyene biosynthesis by a bacterial iterative type I polyketide synthase
rcsb
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 68
structure length 271
sequence length 278
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2022-02-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...