7U2QA

Influenza neuraminidase n1-ca09-snap-155
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
375
structure length
338
Chain Sequence
VKLAGNSSLCPVSGWAPLSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDDRSPYRTLMSVPIGSVPSPYNARFESIAWSASACHDGINWLTIGITGPDNGAVAILKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSSCGPVGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVMHPELTGLDCIVPCFWVELIRTSGSSISFCGVNSDTVGWSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of stabilized recombinant influenza neuraminidase tetramers.
pubmed doi rcsb
molecule tags Viral protein
source organism Influenza a virus
molecule keywords Influenza N1-CA09-sNAp-155
total genus 76
structure length 338
sequence length 375
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.18: exo-alpha-sialidase.
pdb deposition date 2022-02-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...