7UDCB

Cryo-em structures of a synaptobrevin-munc18-1-syntaxin-1 complex class1
Total Genus 75

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
244
structure length
215
Chain Sequence
KDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERAKGRITSEEAADMASGIIMDSSISKQALSIKCENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV1 (22-25)AH2 (28-63)AH3 (69-101)AH5 (110-193)AH4 (103-107)AH1 (4-11)TI1 (20-23)AH6 (204-221)Updating...
connected with : NaN
molecule tags Exocytosis
source organism Rattus norvegicus
publication title SNARE assembly enlightened by cryo-EM structures of a synaptobrevin-Munc18-1-syntaxin-1 complex.
pubmed doi rcsb
molecule keywords Syntaxin-binding protein 1
total genus 75
structure length 215
sequence length 244
ec nomenclature
pdb deposition date 2022-03-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.