7UOOI

Nucleoplasmic pre-60s intermediate of the nog2 containing pre-rotation state
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
131
structure length
131
Chain Sequence
MGRYSVKRYKTKRRTRDLDLIYNDLSTKESVQKLLNQPLDETKPGLGQHYCIHCAKYMETAIALKTHLKGKVHKRRVKELRGVPYTQEVSDAAAGYNLNKFLNRVQEITQSVGPEKESNEALLKEHLDSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 60S ribosomal protein L2-A
total genus 43
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2022-04-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...