7UR2A

Crystal structure of the sec14 domain of the rhogef kalirin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
160
Chain Sequence
DAFFRTGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTFPARHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFPAEIHVALIIKPSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Sec14 domain of Kalirin reveals a distinct class of lipid-binding module in RhoGEFs.
pubmed doi rcsb
molecule tags Lipid binding protein
source organism Rattus norvegicus
molecule keywords Isoform 7 of Kalirin
total genus 43
structure length 160
sequence length 174
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: non-specific serine/threonine protein kinase.
pdb deposition date 2022-04-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...