7UT5A

Acinetobacter baumannii dihydroorotate dehydrogenase bound with inhibitor dsm186
Total Genus 115

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
334
structure length
324
Chain Sequence
MLYSLARPMLFSLAPERAHELTLSMLDKAHKLGMMRQTVEAKPTTCMGIEFPNPVGLAAGLDKNGAHIDALAGLGFGFIEIGTITPRPQSGNPKPRLFRIPEAKAIINRMGFNNDGVDKLIENVKASKFRGILGINIGKNADTPVEKAVDDYLICLEKVYNYASYITVNISSSGDALTELLQTLKARQLELAEQYNHYVPLVLKVAPDLTAEDVEFISAQLLDFKIDGLIVTNTTLSREGVENLPYGNESGGLSGAPVFEKSTECLRLFAQTLKGQIPLIGVGGILSGEQAAAKQQAGATLVQIYSGLIYTGPTLVKQCVEAMT
5010015020025030030025020015010050
020406080100Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (1-12)EMPTYS5 (97-100)AH2 (15-32)TIV6 (93-96)TIV4 (65-68)S1 (44-46)S3 (55-57)TIV2 (51-54)AH9 (298-307)TIV5 (76-79)TIV3 (59-62)TI1 (62-65)AH4 (117-126)AH3 (68-74)S4 (78-84)TVIII2 (85-88)3H1 (101-103)TII2 (254-257)S6 (105-108)TIV9 (309-312)TI4 (251-254)TI'2 (110-113)TIV8 (249-252)AH5 (148-160)S7 (132-137)TIV7 (163-166)TI2 (140-143)3H2 (145-147)TI3 (160-163)O1 (217-219)AH7 (221-234)S10 (238-241)AH8 (269-283)S11 (262-265)S12 (289-291)TI'3 (283-286)S13 (311-314)TVIII3 (285-288)AH10 (316-321)AH11 (323-332)S2 (49-51)S8 (165-169)S9 (211-214)TII1 (248-251)TI5 (256-259)AH6 (183-205)3H3 (266-268)Updating...
connected with : NaN
molecule tags Oxidoreductase/inhibitor
source organism Acinetobacter baumannii
publication title Repurposed dihydroorotate dehydrogenase inhibitors with efficacy against drug-resistant Acinetobacter baumannii.
pubmed doi rcsb
molecule keywords Dihydroorotate dehydrogenase (quinone)
total genus 115
structure length 324
sequence length 334
chains with identical sequence B
ec nomenclature ec 1.3.5.2: dihydroorotate dehydrogenase (quinone).
pdb deposition date 2022-04-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.