7UTIX

Alternative modeling of tropomyosin in human cardiac thin filament in the calcium bound state
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
63
structure length
63
Chain Sequence
DIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERRRAERAEQQRIRNEREKERQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords Actin, alpha skeletal muscle
publication title Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 63
sequence length 63
chains with identical sequence Y, c, d
ec nomenclature
pdb deposition date 2022-04-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...