7V3Mm

Deactive state complex i from rotenone-nadh dataset
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
175
structure length
129
Chain Sequence
MTMYIAFILSTIFVIGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIYLGGMLVVFGYTTAMATGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLIGVVVIMEITRGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
publication title The coupling mechanism of mammalian mitochondrial complex I.
pubmed doi rcsb
total genus 45
structure length 129
sequence length 175
ec nomenclature ec 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
pdb deposition date 2021-08-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...