7V9UA

Cryo-em structure of e.coli retron-ec86 (rt-msdna-rna) at 3.2 angstrom
Total Genus 72

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
309
structure length
309
Chain Sequence
SAEYLNTFRLRNLGLPVMNNLHDMSKATRISVETLRLLIYTADFRYRIYTVEKKGPEKRMRTIYQPSRELKALQGWVLRNILDKLSSSPFSIGFEKHQSILNNATPHIGANFILNIDLEDFFPSLTANKVFGVFHSLGYNRLISSVLTKICCYKNLLPQGAPSSPKLANLICSKLDYRIQGYAGSRGLIYTRYADDLTLSAQSMKKVVKARDFLFSIIPSEGLVINSKKTCISGPRSQRKVTGLVISQEKVGIGREKYKEIRAKIHHIFCGKSSEIEHVRGWLSFILSVDSKSHRRLITYISKLEKKYG
5010015020025030030025020015010050
010203040506070Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (4-15)EMPTYAH6 (129-138)AH3 (34-42)AH7 (143-153)TI1 (43-46)AH4 (70-83)S2 (63-67)TI2 (44-47)S1 (49-53)TI7 (160-163)TI3 (83-86)AH8 (165-186)AH5 (102-107)S8 (242-243)S5 (198-203)TI6 (107-110)S9 (246-248)TI9 (236-239)TII2 (109-112)TVIII1 (112-115)S3 (114-121)TII'1 (195-198)3H1 (124-126)TIV3 (120-123)TIV4 (154-157)TIV5 (155-158)S4 (191-195)AH9 (206-223)TI8 (186-189)S7 (234-235)TIV7 (242-245)TIV8 (249-252)O1 (276-278)AH11 (278-291)AH12 (293-310)TI5 (90-93)TII1 (97-100)AH10 (257-271)AH2 (23-30)Updating...
connected with : NaN
molecule tags Transferase/dna/rna
source organism Escherichia coli
publication title Cryo-EM structures of Escherichia coli Ec86 retron complexes reveal architecture and defence mechanism.
pubmed doi rcsb
molecule keywords RNA-directed DNA polymerase from retron EC86
total genus 72
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2021-08-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.