7VB0I

V1eg domain of v/a-atpase from thermus thermophilus at saturated atp-gamma-s condition, state3
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
TEALLARYRERAEAEAKAVREKAMARLDEAVALVLKEVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural snapshots of V/A-ATPase reveal the rotary catalytic mechanism of rotary ATPases.
pubmed doi rcsb
molecule tags Motor protein
molecule keywords V-type ATP synthase alpha chain
total genus 14
structure length 40
sequence length 40
chains with identical sequence K
ec nomenclature
pdb deposition date 2021-08-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...