7VB2A

Solution structure of human ribosomal protein ul11
Total Genus 26

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
165
structure length
165
Chain Sequence
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
2040608010012014016016014012010080604020
0510152025Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (11-15)AH2 (39-50)TIV2 (64-67)AH4 (125-139)TIV3 (96-99)TIV4 (98-101)TIV5 (99-102)TIV6 (118-121)TIV7 (140-143)AH5 (148-159)TI1 (50-53)AH3 (106-115)TIV9 (160-163)S2 (59-65)AH1 (27-35)S3 (68-74)Updating...
connected with : NaN
molecule tags Ribosomal protein
source organism Homo sapiens
publication title The flexible N-terminal motif of uL11 unique to eukaryotic ribosomes interacts with P-complex and facilitates protein translation.
pubmed doi rcsb
molecule keywords 60S ribosomal protein L12
total genus 26
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2021-08-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.