7VBWA

Structure of the gtp-bound aaa+ atpase domain of the transcriptional regulator gtrr in burkholderia cenocepacia
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
247
structure length
238
Chain Sequence
HSESMQALLHEVDTFADCDTNVLLHGETGVGKERIAQLLHEKHSRYRHGEFVPVNCGAIPDGLFESLFFGHAAHKGYFEQAAGGTLFLDEVGDLPLYQQVKLLRVLEDGAVLRVGATAPVKVDFRLVAASNKKLPQLVKEGLFRADLYYRLAVIELSIPSLEERGAVDKIALFKSFVAQVVGEERLAELSDLPYWLTDSVADSYFPGNVRELRNLAERVGVTVRQTGGWDAARLQRLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses of the AAA+ ATPase domain of the transcriptional regulator GtrR in the BDSF quorum-sensing system in Burkholderia cenocepacia.
pubmed doi rcsb
molecule tags Transcription
source organism Burkholderia cenocepacia
molecule keywords Sigma-54 dependent trancsriptional regulator
total genus 84
structure length 238
sequence length 247
ec nomenclature
pdb deposition date 2021-09-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...