7VH1B

Cryo-em structure of machupo virus dimeric l-z complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
49
structure length
49
Chain Sequence
YGRYNCKCCWFADTNLITCNDHYLCLRCHQTMLRNSELCHICWKPLPTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Machupo virus polymerase in complex with matrix protein Z
rcsb
molecule keywords RNA-directed RNA polymerase L
molecule tags Viral protein
source organism Machupo virus
total genus 4
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2021-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
B PF03854 zf-P11 P-11 zinc finger
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...