7VKVX

Nmr structure of the zeta-subunit of the f1f0-atpase from sinorhizobium meliloti
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
MQDREKAFEAKFALDEELRFKATARRNKLLGLWAAGLLAKSDPEAYASEIVAADFEEAGHEDVVRKIKTDFDAAGVAISEDDIRVRMIELLSEAVAQLQKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the zeta-subunit of the F1F0-ATPase from Sinorhizobium meliloti
rcsb
molecule tags Protein binding
source organism Sinorhizobium meliloti 1021
molecule keywords zeta-subunit
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2021-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07345 DUF1476 ATPase inhibitor subunit zeta
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...