7VLDC

Oxy-deoxy intermediate of v2 hemoglobin at 69% oxygen saturation
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
149
structure length
149
Chain Sequence
SNSCTTEDRREMQLMWANVWSAQFTGRRLAIAQAVFKDLFAHVPDAVGLFDRVHGTEIDSSEFKAHCIRVVNGLDSAIGLLSDPSTLNEQLSHLATQHQERAGVTKGGFSAIAQSFLRVMPQVASCFNPDAWSRCFNRITNGMTEGLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of oxygen dissociation intermediates of 400 kDa V2 hemoglobin provide coarse snapshots of the protein allostery.
pubmed doi rcsb
molecule keywords Extracellular A1 globin
molecule tags Oxygen transport
total genus 58
structure length 149
sequence length 149
chains with identical sequence G
ec nomenclature
pdb deposition date 2021-10-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...