7VRKA

Crystal structure of brd2-bd1 in complex with purine derivative
Total Genus 37

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
108
structure length
108
Chain Sequence
VTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQ

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTVIII1 (99-102)TI1 (93-96)3H1 (97-99)TIV1 (104-107)AH1 (77-92)Updating...
connected with : NaN
molecule tags Transcription/inhibitor
source organism Homo sapiens
publication title crystal structure of BRD2-BD1 in complex with purine derivative
rcsb
molecule keywords Bromodomain-containing protein 2
total genus 37
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2021-10-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.