7VVGC

Crystal structure of hrasg12v(gmppnp-bound) in complex with the ras-binding domain(rbd) of sin1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
77
Chain Sequence
ESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLVRENSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords GTPase HRas
publication title Structural insights into Ras regulation by SIN1.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 77
sequence length 82
ec nomenclature
pdb deposition date 2021-11-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...