7VVSA

Pll9 induced tmftn nanocage
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
163
structure length
163
Chain Sequence
MVISEKVRKALNDQLNREIYSSYLYLSMATYFDAEGFKGFAHWMKKQAQEELTHAMKFYEYIYERGGRVELEAIEKPPSNWNGIKDAFEAALKHEEFVTQSIYNILELASEEKDHATVSFLKWFVDEQVEEEDQVREILDLLEKANGQMSVIFQLDRYLGQRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PLL9 induced TmFtn nanocage
rcsb
molecule tags Protein binding
source organism Thermotoga maritima (strain atcc 43589 / dsm 3109 / jcm 10099 / nbrc 100826 / msb8)
molecule keywords Ferritin
total genus 77
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.16.3.2: bacterial non-heme ferritin.
pdb deposition date 2021-11-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...