7W0WA

The novel membrane-proximal sensing mechanism in a broad-ligand binding chemoreceptor mcpa of bacillus velezensis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
131
Chain Sequence
INDMINTSISQKEDGTAYFSDWLTKDRYKPKNQSQITDKFTEYMKINKDVESIYTSDTEGHFTRYPDLQMPKGYNPIERDWYKKAVENKGKVVVTDPYRTASTNTMVVTVVQQTKDGSGVVAINMKIDELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Signal binding at both modules of its dCache domain enables the McpA chemoreceptor of Bacillus velezensis to sense different ligands.
pubmed doi rcsb
molecule tags Protein binding
source organism Bacillus velezensis
molecule keywords Methyl-accepting chemotaxis protein
total genus 44
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2021-11-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...