7W5CA

Crystal structure of mitogen activated protein kinase 4 (mpk4) from arabidopsis thaliana
Total Genus 111

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
355
structure length
355
Chain Sequence
GVATHGGSYVQYNVYGNLFEVSRKYVPPLRPIGRGAYGIVCAATNSETGEEVAIKKIGNAFDNIIDAKRTLREIKLLKHMDHENVIAVKDIIKPPQRENFNDVYIVYELMDTDLHQIIRSNQPLTDDHCRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSAGAVDLLEKMLVFDPSRRITVDEALCHPYLAPLHDINEEPVCVRPFNFDFEQPTLTEENIKELIYRETVKFNP
5010015020025030035035030025020015010050
020406080100Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI'1 (21-24)TI'2 (22-25)S4 (42-51)AH1 (81-96)S2 (26-31)TI1 (39-42)S3 (34-39)S5 (55-62)TIV2 (52-55)S7 (105-109)TI2 (62-65)TI3 (63-66)S6 (67-74)3H4 (327-332)TI4 (76-79)TIV3 (74-77)TI16 (348-351)AH10 (320-325)O1 (137-139)TI17 (351-354)TI5 (99-102)TVIII5 (341-344)TI6 (113-116)TVIII2 (111-114)TIV4 (114-117)AH3 (143-163)S8 (120-125)S9 (129-130)TIV9 (311-314)TVIII4 (218-221)AH2 (131-136)S10 (165-166)3H1 (172-174)TVIII3 (204-207)TI8 (188-191)S11 (175-177)S12 (183-185)S13 (192-193)AH4 (212-216)AH9 (300-309)TI9 (193-196)TI10 (194-197)TI11 (206-209)TI12 (207-210)AH5 (223-239)TI13 (268-271)TIV6 (242-245)TIV7 (246-249)3H2 (265-268)AH7 (274-282)AH8 (291-294)TIV8 (295-298)3H3 (314-316)O2 (309-311)TI14 (334-337)TI15 (335-338)TIV1 (30-33)TIV5 (167-170)TI7 (178-181)S1 (19-21)AH6 (249-260)Updating...
connected with : NaN
molecule tags Transferase
source organism Arabidopsis thaliana
publication title Essential role of the CD docking motif of MPK4 in plant immunity, growth, and development.
pubmed doi rcsb
molecule keywords Mitogen-activated protein kinase 4
total genus 111
structure length 355
sequence length 355
ec nomenclature ec 2.7.11.24: mitogen-activated protein kinase.
pdb deposition date 2021-11-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.