7W71H

Crystal structure of the pdz-c domain of e. coli rsep in complex with 12c7 fab
Total Genus 38

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
211
Chain Sequence
QVQLQQSRAELARPGASVKMSCKASGYTFTTYTMQWVKQRPGQALEWIGYINPGSGYAKNNQKFKDKATLTADKSSSTAYMQLSSLTSDDSAVYYCARSGSFFDYWGQGTTLTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS2 (10-12)TIV1 (13-16)S4 (22-25)S9 (78-83)TI5 (74-77)TI1 (28-31)S5 (34-39)TIV7 (99-102)3H1 (88-90)TII1 (40-43)S6 (45-51)TIV3 (61-64)TII2 (52-55)TIV2 (53-56)TI4 (73-76)S7 (58-60)TI3 (64-67)TIV6 (83-86)S10 (92-98)S11 (105-106)S16 (166-174)S14 (138-148)S13 (123-127)S18 (196-202)TIV12 (192-195)TI6 (187-190)TI7 (188-191)3H2 (158-160)S17 (177-187)TIV8 (160-163)S19 (207-213)3H3 (203-205)TIV11 (191-194)S1 (3-6)S12 (110-114)S3 (18-20)S8 (68-73)TIV10 (173-176)TVIb1 (190-193)S15 (154-157)Updating...
connected with : NaN
molecule tags Hydrolase/immune system
source organism Escherichia coli
publication title Mechanistic insights into intramembrane proteolysis by E. coli site-2 protease homolog RseP.
pubmed doi rcsb
molecule keywords Regulator of sigma-E protease RseP
total genus 38
structure length 211
sequence length 217
chains with identical sequence I
ec nomenclature
pdb deposition date 2021-12-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.