7W71L

Crystal structure of the pdz-c domain of e. coli rsep in complex with 12c7 fab
Total Genus 46

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
DIVLTQSPAILSVTPGDSVSLSCRASQSVSSNLHWYQQRSHESPRLLITYAFQSISGIPSRFSGNGSGTDFTLNINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS9 (97-98)TIV3 (25-28)S10 (102-106)S2 (10-13)TIV2 (14-17)TVIII1 (75-78)S3 (19-25)TIV8 (67-70)TII'1 (29-32)S4 (33-38)TI2 (79-82)TII1 (39-42)TIV4 (48-51)TIV5 (49-52)TIV7 (55-58)TI1 (59-62)S8 (84-90)TIV9 (93-96)S16 (173-182)AH1 (122-127)S12 (129-139)S13 (145-150)TIV10 (149-152)S17 (191-198)S14 (153-155)TII2 (156-159)TIV12 (168-171)TIV11 (167-170)AH2 (183-187)S18 (201-210)S1 (4-7)TIV1 (8-11)TIV6 (50-53)S5 (45-48)S6 (62-67)S7 (70-75)S11 (114-118)S15 (159-164)Updating...
connected with : NaN
molecule tags Hydrolase/immune system
source organism Escherichia coli
publication title Mechanistic insights into intramembrane proteolysis by E. coli site-2 protease homolog RseP.
pubmed doi rcsb
molecule keywords Regulator of sigma-E protease RseP
total genus 46
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2021-12-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.