7WG5D

Cyclic electron transport supercomplex ndh-psi from arabidopsis
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
497
structure length
497
Chain Sequence
DFPWLTIIVVFPISAGSLMLFLPHRGNKVNKWYTICICILELLLTTYAFCYNFKMDDPLIQLSEDYKWIDFFDFYWRMGIDGLSIGTILLTGFITTLATLAAFPVTRDSRFFHFLMLAMYSGQIGSFSSRDLLLFFIMWELELIPVYLLLSMWGGKKRLYSATKFILYTAGSSIFLLIGVLGISLYGSNEPTLNLELLANKSYPVTLEILFYIGFLIAFAVKSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSMFSPWLLVVGTIQIIYAASTSPGQRNLKKRIAYSSVSHMGFIIIGISSITDPGLNGAILQIISHGFIGAALFFLAGTSYDRIRLVYLDEMGGMAISIPKIFTMFTILSMASLALPGMSGFIAEFIVFFGIITSQKYFLISKIFIIFVMAIGMILTPIYLLSMLRQMFYGYKLINIKNFSFFDSGPRELFLSISILLPIIGIGIYPDFVLSLASDKVESILSNYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
total genus 165
structure length 497
sequence length 497
ec nomenclature ec 7.1.1.-:
pdb deposition date 2021-12-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...