7WIMA

Crystal structure of arabidopsis thaliana fkbp43 n-terminal domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
87
Chain Sequence
AFWGVEVKPGKTFTLKIRRLHLSQATLGHGTATNRSILQCNKSPLLLCVLTPDKVDSCQLNLEFEETDEVIFSVIGPRSVHLTGYFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The plant nucleoplasmin AtFKBP43 needs its extended arms for histone interaction.
pubmed doi rcsb
molecule tags Chaperone
source organism Arabidopsis thaliana
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP43
total genus 12
structure length 87
sequence length 96
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 5.2.1.8: peptidylprolyl isomerase.
pdb deposition date 2022-01-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...