7WN8A

Crystal structure of antibody (bc31m5) binds to cd47
Total Genus 24

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVV

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV4 (79-82)AH1 (102-107)S1 (27-30)S7 (98-101)TI1 (31-34)TVIII1 (34-37)S2 (36-39)3H1 (51-53)TVIII2 (48-51)TIV1 (43-46)TIV2 (59-62)TIV3 (60-63)S4 (64-69)TI3 (81-84)S6 (85-86)3H2 (70-72)S5 (74-76)3H3 (88-93)S8 (110-118)S3 (54-59)TI2 (78-81)Updating...
connected with : NaN
molecule tags Antitumor protein
source organism Homo sapiens
publication title Crystal structure of antibody BC31M5 binds to Leukocyte surface antigen CD47.
rcsb
molecule keywords Leukocyte surface antigen CD47
total genus 24
structure length 116
sequence length 116
chains with identical sequence C
ec nomenclature
pdb deposition date 2022-01-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.