7WP6B

Cryo-em structure of sars-cov-2 recombinant spike protein stfk in complex with three neutralizing antibodies
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
VQLQQSGPELVNPGASVKISCKTSGYTFTEYTMHWVKQSHGKSLEWIGGINPNNGDTIYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVFYCAREGDYYVSSYGYWGQGTTLTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords 36H6 heavy chain
publication title Cryo-EM structure of SARS-CoV-2 S2P trimer in complex with neutralizing antibody VacW-209 (local refinement)
rcsb
source organism Severe acute respiratory syndrome coronavirus 2
total genus 16
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2022-01-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...