7WUOA

Unravelling structure of riboflavin synthase for designing of potential anti-bacterial drug
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
201
structure length
201
Chain Sequence
MFTGLVETTGKILEIQETNEGRGFLVETKWVQPDLKLGDSISVNGCCQTVTEFTNEGSRFRFYASFKTLELTNFKFLKVGEEVNLERSALPTTRLGGHLVSGHVDGTGKILSKEEREGGAVICYTVQNDPSLSRYIAPRGSITVDGISLTVVDSRPKEFDLVLIPETLKKTNAKSWNSDTILNLEIDLVARYLEQLLKSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Riboflavin synthase
publication title Unraveling the crystal structure of Leptospira kmetyi riboflavin synthase and computational analyses for potential development of new antibacterials
doi rcsb
source organism Leptospira kmetyi serovar malaysia str. bejo-iso9
total genus 51
structure length 201
sequence length 201
chains with identical sequence B, C
ec nomenclature ec 2.5.1.9: riboflavin synthase.
pdb deposition date 2022-02-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...