7X6OC

Cryo-em structure of h1 hemagglutinin from a/washington/05/2011 in complex with a neutralizing antibody 28-12
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
229
structure length
229
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYNMNWVRQAPGKGLEWLSYISTSSNTIYYADSVKGRFTISRDNAKNSLFLQMNSLRDEDTAVYYCARDRGCSSTNCYVVGYYFYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique binding pattern for a lineage of human antibodies with broad reactivity against influenza A virus.
pubmed doi rcsb
molecule keywords Hemagglutinin
molecule tags Viral protein
source organism Influenza a virus
total genus 23
structure length 229
sequence length 229
chains with identical sequence I, J
ec nomenclature
pdb deposition date 2022-03-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...