7XB23

Cvb5-intermediate altered particle containing vp1/vp2/vp3 and rna genome
Total Genus 32

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
238
structure length
231
Chain Sequence
GLPTMLTPGSNQFLTSDDFQSPSAMPQFDVTPEMDIPGQVNNLMEIAEVDSVVPVNNTEGKVLSIESYQIPVQSNSTNGSQVFGFPLMPGASSVLNRTLLGEILNYYTHWSGSIKLTFMFCGSAMATGKFLLAYSPPGAGAPTTRKEAMLGTHVIWDVGLQSSCVLCIPWISQTHYRTAGGYITCWYQTNIVVPADTQSDCKILCFVSACNDFSVRMLKDTPFIKQDNFYQ

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TII1 (7-10)AH2 (99-105)S1 (51-53)TIV3 (54-57)TII4 (58-61)S2 (69-72)TI1 (61-64)3H1 (65-67)EMPTYTVIII2 (73-76)S3 (80-86)TII5 (77-80)TIV5 (89-92)TI2 (88-91)TI4 (95-98)TIV6 (92-95)TI3 (93-96)S4 (107-111)TI7 (217-220)TVIII3 (168-171)S10 (208-216)S5 (114-120)TI5 (123-126)S6 (127-135)TI6 (157-160)TII6 (136-139)S7 (153-157)AH1 (43-48)S9 (189-199)AH3 (145-150)TIV7 (158-161)S8 (163-168)Updating...
connected with : NaN
molecule tags Virus
source organism Coxsackievirus b5
publication title Atomic Structures of Coxsackievirus B5 Provide Key Information on Viral Evolution and Survival.
pubmed doi rcsb
molecule keywords Genome polyprotein
total genus 32
structure length 231
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2022-03-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.