7XC1A

Crystal structure of erk2 with an allosteric inhibitor 3
Total Genus 112

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
351
structure length
350
Chain Sequence
GPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
5010015020025030030025020015010050
020406080100Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI'1 (14-17)S1 (25-34)S2 (37-44)O1 (19-21)TI1 (22-25)TI2 (45-48)TIV3 (44-47)3H1 (95-97)AH1 (62-77)S4 (88-91)AH3 (126-143)TIV4 (122-126)TI4 (80-83)TIV10 (335-338)AH11 (340-351)TVIII4 (331-334)S5 (101-106)TIV5 (147-150)S7 (145-146)S6 (110-111)AH5 (207-223)AH10 (304-309)AH2 (112-118)3H5 (311-313)3H2 (152-154)TIV9 (295-298)TI15 (313-316)3H6 (319-321)S8 (155-159)TI5 (159-162)TI7 (175-178)S9 (162-165)S10 (172-173)TI6 (168-171)3H3 (191-193)TI8 (182-185)AH9 (284-294)AH6 (233-244)AH4 (196-201)TI11 (250-253)TVIII2 (226-229)TI9 (248-251)TI10 (249-252)TIV7 (251-254)TI12 (252-255)TIV8 (255-258)AH7 (260-266)TI14 (279-282)3H4 (298-300)AH8 (275-278)TIV1 (13-16)S3 (49-56)TVIII3 (325-328)TI3 (58-61)TIV2 (34-37)TIV6 (230-233)Updating...
connected with : NaN
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title Structural basis for ERK2 allosteric inhibitors.
rcsb
molecule keywords Mitogen-activated protein kinase 1
total genus 112
structure length 350
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.7.11.24: mitogen-activated protein kinase.
pdb deposition date 2022-03-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.