7XEAA

T4 lysozyme mutant-s44c/c54t/n68c/a93c/c97a/t115c, dmso 40%, and then backsoaking
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
163
structure length
163
Chain Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKCELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFCNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Creation of Cross-Linked Crystals With Intermolecular Disulfide Bonds Connecting Symmetry-Related Molecules Allows Retention of Tertiary Structure in Different Solvent Conditions.
pubmed doi rcsb
molecule tags Hydrolase
source organism Escherichia virus t4
molecule keywords Endolysin
total genus 58
structure length 163
sequence length 163
ec nomenclature ec 3.2.1.17: lysozyme.
pdb deposition date 2022-03-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...