7XM0A

Crystal structure of sau3ai-c and dna substrate complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
258
structure length
258
Chain Sequence
MKEKSIEDIVFEKFQPYINWSIDKLCEHFSINKGEKGLNYRIASAILNLKGKTTKSKPFPEVEEFEKSSIVVKTVHFNKKNVNKESMSFGAFKFEELANEEWEDSEGYPSAQWRNFLLETRFLFFVVKEDEDGVDIFKGIKFFSMPEEDINGPVKRMWDDTVKKLKEGVTLEAVPDKSTKDGWRIKNNFVDKSDDLICHVRPHTNNRDYRGGSNADKLPKKINWINRPDSDDYSDEWMTKQSFWINNDYIKKQVEDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Type II restriction enzyme Sau3AI
publication title The Self-Activation Mechanism of Type IIE Restriction Endonuclease Sau3AI
rcsb
source organism Staphylococcus aureus
total genus 69
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature ec 3.1.21.4: type II site-specific deoxyribonuclease.
pdb deposition date 2022-04-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...