7XOXE

Structural insights into human brain gut peptide cholecystokinin receptors
Total Genus 38

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
246
structure length
230
Chain Sequence
VQLVESGGGLVQPGGSRKLSCSASGFAFSSFGMHWVRQAPEKGLEWVAYISSGSGTIYYADTVKGRFTISRDDPKNTLFLQMTSLRSEDTAMYYCVRSIYYYGSSPFDFWGQGTTLTVSSDIVMTQATSSVPVPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLTISRLEAEDVGVYYCMQHLEYPLTFGAGTKLEL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS3 (16-25)S2 (10-12)TII1 (13-16)TIV4 (73-76)3H1 (29-31)S7 (68-73)S5 (45-51)TI'1 (53-56)S6 (58-60)TI2 (61-64)TII3 (64-67)TI4 (87-90)TI3 (74-77)S10 (110-119)TIV6 (88-91)S9 (93-99)TII4 (102-105)S18 (213-219)S14 (174-178)TIV7 (106-109)S13 (162-167)TIV12 (220-223)S12 (143-148)S11 (134-135)S17 (199-204)TII7 (196-199)S16 (191-196)TI5 (155-158)TIV11 (208-211)TII5 (168-171)TIV8 (177-180)S15 (182-183)TII6 (184-187)TIV10 (204-207)TI6 (188-191)S1 (3-7)S8 (78-86)O1 (27-29)S4 (33-39)Updating...
connected with : NaN
molecule tags Neuropeptide
source organism Homo sapiens
publication title Structural insights into human brain-gut peptide cholecystokinin receptors.
pubmed doi rcsb
molecule keywords Gastrin/cholecystokinin type B receptor
total genus 38
structure length 230
sequence length 246
ec nomenclature
pdb deposition date 2022-05-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.