7XPLE

Crystal structure of a c/d-free rna-guided rna 2'-o-methyltransferase
Total Genus 77

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
231
structure length
231
Chain Sequence
SEVITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYKG

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV2 (38-41)S1 (4-9)S4 (43-46)TII1 (12-15)S2 (15-20)AH2 (89-98)TI1 (20-23)S3 (24-30)TVIII1 (31-34)TII2 (33-36)S5 (49-53)TIV1 (37-40)TIV3 (45-48)TI2 (55-58)AH1 (60-67)TI3 (56-59)S9 (147-152)TVIa1 (216-219)S11 (208-215)TII3 (75-78)TI4 (99-102)TI11 (141-144)S6 (79-83)TI5 (124-127)S7 (103-108)AH3 (111-123)AH4 (158-170)TI6 (133-136)TI7 (136-139)TIV6 (137-140)TIV5 (134-137)TI9 (139-142)TI10 (140-143)TI8 (138-141)S10 (171-182)AH6 (192-205)TIV8 (220-223)TVIII2 (218-221)AH5 (183-186)S12 (223-230)TIV7 (217-220)TIV4 (82-85)TII'1 (85-88)TI12 (187-190)S8 (127-131)Updating...
connected with : NaN
molecule tags Rna binding protein/rna
source organism Saccharolobus solfataricus
publication title Methylation guide RNAs without box C/D motifs.
pubmed doi rcsb
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 subunit
total genus 77
structure length 231
sequence length 231
chains with identical sequence F
ec nomenclature ec 2.1.1.-:
pdb deposition date 2022-05-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.