7XWHA

Structure of patulin-detoxifying enzyme with nadp+
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
250
structure length
223
Chain Sequence
MEQTYFISGANRGIGFSVVQRLAAKSGVKVIATARDPASATALNELAKENPQVKVVQLDISDEESIKKIAKNVSQYTDSIDVFVSNAAIAKSFGPLLNTPREQWIEHFFTNVLGPIRLFQELYPLIKKGTQKKVFFISSNAGSLNLDFGLDFSAYGQSKAALNYSTKELARQLKPENFIVAAVHPGVVTKITPEESAAALCKLFESLNTTGKYLSYDGTELPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based rational design of a short-chain dehydrogenase/reductase for improving activity toward mycotoxin patulin
doi rcsb
molecule tags Oxidoreductase
source organism Meyerozyma guilliermondii
molecule keywords Short-chain dehydrogenase/reductase
total genus 76
structure length 223
sequence length 250
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: alcohol dehydrogenase.
pdb deposition date 2022-05-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...