7Y5EA6

In situ single-pbs-psii-psi-lhcs megacomplex.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
334
structure length
334
Chain Sequence
ASLWERFCSWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFVAAPPVDIDGIREPVAGSLLYGNNIISGAVIPSSAAIGIHFYPIWEAASLDEWLYNGGCYPLIVLHFLLGVACYMGREWELSYRLGMRPWIAVAFSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGLWPVVGIWLTSISVSTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.
pubmed doi rcsb
molecule tags Photosynthesis
source organism Porphyridium purpureum
molecule keywords Phycoerythrin alpha subunit
total genus 88
structure length 334
sequence length 334
chains with identical sequence AL, a6, aL
ec nomenclature ec 1.10.3.9: photosystem II.
pdb deposition date 2022-06-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...