7Y7NA

Crystal structure of duf371 domain-containing protein from methanobrevibacter ruminantium
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
137
structure length
137
Chain Sequence
MNFKIKAKGHKNVLSLHKSTFEITKDKDLSLSGDCIIGLDIDKCMLDFPKEFKEKLANDETIVTVKLKSPNAYDEIVGYGHHDLTLDHPTDIVCRKSDFICSRTLMIKSDKAAIDLNRDLIEDLANGESLDVEIILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DUF371 domain-containing protein from methanobrevibacter ruminantium
rcsb
molecule keywords Uncharacterized protein
molecule tags Structural genomics
source organism Methanobrevibacter ruminantium
total genus 36
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2022-06-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...