7YCOB

Crystal structure of sars-cov-2 receptor binding domain bound to a6 repebody
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
260
structure length
260
Chain Sequence
TPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIYAPDSDIKSVQGIQYLPNVRSLKLRSNKLHDISALKELTNLTFLFLNLNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTLLHLMVNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPEGVFDKLTQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRSFIPLWAPDSAKCSGSGKPVRSIICPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SARS-CoV-2 Receptor Binding Domain bound to A6 repebody
rcsb
molecule tags Protein binding
source organism Severe acute respiratory syndrome coronavirus 2
molecule keywords Spike protein S1
total genus 76
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2022-07-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...