7YCVA

The dimeric format of truncated prpa (2-54)and rhh domain of prpa
Total Genus 17

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
55
structure length
55
Chain Sequence
RTMTVDTGEELRAFVEGLVESGDYKTNSEVIRDGLRLLQEKTAGSKLAALRLEHH

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYAH1 (12-24)AH2 (30-47)AH3 (49-56)TVIII1 (25-28)Updating...
connected with : NaN
molecule tags Antitoxin
source organism Pseudoalteromonas rubra
publication title Structural insights into the PrpTA toxin-antitoxin system in Pseudoalteromonas rubra.
pubmed doi rcsb
molecule keywords Antitoxin ParD
total genus 17
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2022-07-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.