7YE2E

The cryo-em structure of c. crescentus gcra-tacdown
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
RVTVEDCVEKVPNRFALVLLSAHRARGISAGAALMVDRDNDKNPVVALREIADDVIDHEGLKEHLISTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structures of Caulobacter crescentus transcription activation complex with an essential cell cycle regulator GcrA
rcsb
molecule tags Transcription
source organism Caulobacter vibrioides na1000
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 13
structure length 69
sequence length 69
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2022-07-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...