7YLLA

Crystal structure of ttedbh
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
337
structure length
329
Chain Sequence
RKIIHVDMDAFFASIEQQDNPEYRGKPVIVGGLSGRGVVSTCSYEARKYGIHSAMPMYMAKKLCPQGIFLPVRRKRYEEVSEQIFRILYDITPFVEPVSIDEAYLDVTHVDKNPEDIALEIKKRVKDATGLTVSVGISYNKFLAKLASDWNKPDGLMVITEDMVPEILKPLPVTKVHGIGEKSAEKLRSIGIETVEDLLKLFGKTGVEIYNRIRGIDERPVETMREIKSIGKEKTLEKDTKNKELLIQHLKEFSEIVSEELIKERLYCRTVTVKIKTADFAVHTKSKTVDKYIRFSEDIYEVAKGILEEWKLEQYVRLIGLSVSNLSPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of extreme TLS DNA polymerase TTEDbh from Thermoanaerobacter tengcongensis.
pubmed doi rcsb
molecule tags Transferase
source organism Thermoanaerobacter tengcongensis (strain dsm 15242 / jcm 11007 / nbrc 100824 / mb4)
molecule keywords DNA polymerase IV
total genus 97
structure length 329
sequence length 337
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2022-07-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...