7YNEB

Crystal structure of fragmin domain-1 (1-160) in complex with g-form actin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
140
Chain Sequence
TELEKKVKLEASQHEDAWKGAGKQVGVEIWRIQQFKVVPVPKKHHGSFYTGDSYIVLSTYHPKTNPDKLAYDVHFWLGAFTTQDEAGTAAYKTVELDDYLGGLPVQYREVQGYESERFLSLFPGLRILDGGVETGFHHVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and mechanisms of actin ATP hydrolysis.
pubmed doi rcsb
molecule tags Contractile protein
source organism Physarum polycephalum
molecule keywords Actin, alpha skeletal muscle
total genus 43
structure length 140
sequence length 142
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2022-07-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...