7YRYg

F1-atpase of acinetobacter baumannii
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
288
Chain Sequence
ANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRPYADNMRRVIAHLVQANPEYKHRYMVDRPVKRVGYIIVSSDRGLAGGLNINLFKKVVQHVKAQQEQSIEVQFALIGQKAVSFFKNYGGKVLGATTQIGDAPSLEQLTGSVQVMLDAFDKGELDRIYLVSNGFVNAMTQKPKVEQLVPLAPAEEGDDLNRTYGWDYIYEPEAEELLNGLLVRYIESMVYQGVIENVACEQSARMVAMKAATDNAGQLIKDLQLIYNKLRQAAITQEISEIVGGAAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP synthase subunit alpha
publication title Atomic insights of an up and down conformation of the Acinetobacter baumannii F 1 -ATPase subunit epsilon and deciphering the residues critical for ATP hydrolysis inhibition and ATP synthesis.
pubmed doi rcsb
source organism Acinetobacter baumannii ab5075
total genus 91
structure length 288
sequence length 288
ec nomenclature
pdb deposition date 2022-08-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...