7Z0OB

Structure of transcription factor uaf in complex with tbp and 35s rrna promoter dna
Total Genus 23

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGF

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI1 (26-29)TI2 (27-30)AH1 (32-42)TIV1 (28-31)AH2 (51-77)TIV2 (48-51)Updating...
connected with : NaN
publication title Mechanism of RNA polymerase I selection by transcription factor UAF.
pubmed doi rcsb
molecule keywords Histone H3
molecule tags Transcription
source organism Saccharomyces cerevisiae
total genus 23
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2022-02-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.