7Z8ZB

Crystal structure of the meilb2-brme1 2:2 core complex
Total Genus 13

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
34
structure length
34
Chain Sequence
RMQDATDTVRGLVVELSGLNRLIMSTHRDLEAFK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Recombination
source organism Mus musculus
publication title MEILB2-BRME1 acts as a DNA clamp upon dimerisation induced by BRCA2-binding in meiotic recombination.
rcsb
molecule keywords Heat shock factor 2-binding protein
total genus 13
structure length 34
sequence length 34
chains with identical sequence D
ec nomenclature
pdb deposition date 2022-03-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.