7ZAHS

Cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna, mrna, aif1a and aif5b
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
GKIRQGFIKRVARELFNKYPNEFTRDFEHNKKKVEELTNVTSKKIRNRIAGYITKLVRMKEEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of aIF5B in archaeal translation initiation.
pubmed doi rcsb
molecule tags Translation
source organism Pyrococcus abyssi ge5
molecule keywords 16S rRNA
total genus 19
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2022-03-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...